PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009779886.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 245aa    MW: 25958.9 Da    PI: 8.4158
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009779886.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.5e-382382362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     ++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  XP_009779886.1 23 PEHLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGSRKNAKRS 82
                    57899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-291980IPR003851Zinc finger, Dof-type
PfamPF027012.6E-332580IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2642680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MPSDVSERKA TKQQQGAAPA PEPEHLPCPR CDSTNTKFCY YNNYNFSQPR HFCKSCRRYW  60
THGGTLRDIP VGGGSRKNAK RSRTITTNNT SSSTSSCLSS TLSPRDYHHA PTPSHVSPFL  120
VPLTADHHGG PLPFDVKPNG NMCGSFTSLL SNTQGPHGLL ALSGFGLGVG PAIEDMGFGL  180
GRPIWPFPGV VSHTSVDHSN SNGAGASMLG NTWQLASGEG GFVGAGGDCF NFPELAISTH  240
GNGMK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779886.10.0PREDICTED: dof zinc finger protein DOF3.4-like
RefseqXP_016483903.10.0PREDICTED: dof zinc finger protein DOF3.4-like
TrEMBLM1AMQ11e-128M1AMQ1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000261371e-127(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.16e-45OBF binding protein 1